SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4klnd1 (4kln D:12-106)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2061141Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2061195Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2061380Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 2061381Protein automated matches [191195] (7 species)
    not a true protein
  7. 2061405Species Human (Homo sapiens) [TaxId:9606] [255865] (6 PDB entries)
  8. 2061425Domain d4klnd1: 4kln D:12-106 [253327]
    Other proteins in same PDB: d4klna2, d4klna3, d4klnb2, d4klnb3, d4klnc2, d4klnc3, d4klnd2, d4klnd3, d4klne2, d4klne3, d4klnf2, d4klnf3
    automated match to d1e32a1
    complexed with ags, mg; mutant

Details for d4klnd1

PDB Entry: 4kln (more details), 2.62 Å

PDB Description: Structure of p97 N-D1 A232E mutant in complex with ATPgS
PDB Compounds: (D:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d4klnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4klnd1 b.52.2.0 (D:12-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavciv
lsddtcsdekirmnrvvrnnlrvrlgdvisiqpcp

SCOPe Domain Coordinates for d4klnd1:

Click to download the PDB-style file with coordinates for d4klnd1.
(The format of our PDB-style files is described here.)

Timeline for d4klnd1: