Class b: All beta proteins [48724] (176 folds) |
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies) barrel, closed; n=6, S=10; complex topology with crossover (psi) loops |
Superfamily b.52.2: ADC-like [50692] (4 families) |
Family b.52.2.0: automated matches [191648] (1 protein) not a true family |
Protein automated matches [191195] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255865] (6 PDB entries) |
Domain d4klnc1: 4kln C:12-106 [253324] Other proteins in same PDB: d4klna2, d4klna3, d4klnb2, d4klnb3, d4klnc2, d4klnc3, d4klnd2, d4klnd3, d4klne2, d4klne3, d4klnf2, d4klnf3 automated match to d1e32a1 complexed with ags, mg; mutant |
PDB Entry: 4kln (more details), 2.62 Å
SCOPe Domain Sequences for d4klnc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4klnc1 b.52.2.0 (C:12-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} lstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavciv lsddtcsdekirmnrvvrnnlrvrlgdvisiqpcp
Timeline for d4klnc1: