Lineage for d4klnb3 (4kln B:201-462)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1597497Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 1597800Protein automated matches [190766] (3 species)
    not a true protein
  7. 1597809Species Human (Homo sapiens) [TaxId:9606] [255867] (6 PDB entries)
  8. 1597827Domain d4klnb3: 4kln B:201-462 [253323]
    Other proteins in same PDB: d4klna1, d4klna2, d4klnb1, d4klnb2, d4klnc1, d4klnc2, d4klnd1, d4klnd2, d4klne1, d4klne2, d4klnf1, d4klnf2
    automated match to d1e32a2
    complexed with ags, mg; mutant

Details for d4klnb3

PDB Entry: 4kln (more details), 2.62 Å

PDB Description: Structure of p97 N-D1 A232E mutant in complex with ATPgS
PDB Compounds: (B:) Transitional endoplasmic reticulum ATPase

SCOPe Domain Sequences for d4klnb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4klnb3 c.37.1.20 (B:201-462) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgyddiggcrkqlaqikemvelplrhpalfkeigvkpprgillygppgtgktliaravan
etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
vmnslavtmddfrwalsqsnps

SCOPe Domain Coordinates for d4klnb3:

Click to download the PDB-style file with coordinates for d4klnb3.
(The format of our PDB-style files is described here.)

Timeline for d4klnb3: