Lineage for d4kl6a1 (4kl6 A:1-134)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2407441Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. 2407442Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (3 families) (S)
    duplication: contains two intertwined structural repeats
  5. 2407476Family b.86.1.0: automated matches [254252] (1 protein)
    not a true family
  6. 2407477Protein automated matches [254576] (3 species)
    not a true protein
  7. 2407478Species Nostoc punctiforme [TaxId:63737] [255340] (3 PDB entries)
  8. 2407481Domain d4kl6a1: 4kl6 A:1-134 [253314]
    Other proteins in same PDB: d4kl6a2, d4kl6b2, d4kl6c2, d4kl6d2
    automated match to d4o1ra_

Details for d4kl6a1

PDB Entry: 4kl6 (more details), 2.2 Å

PDB Description: crystal structure of dimeric form of npudnae intein
PDB Compounds: (A:) DNA-directed DNA polymerase,Nucleic acid binding, OB-fold, tRNA/helicase-type

SCOPe Domain Sequences for d4kl6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kl6a1 b.86.1.0 (A:1-134) automated matches {Nostoc punctiforme [TaxId: 63737]}
alsyeteiltveygllpigkivekriectvysvdnngniytqpvaqwhdrgeqevfeycl
edgsliratkdhkfmvdgqmlpideifereldlmrnpgikiatrkylgkqnvydigverd
hnfalkngfiasna

SCOPe Domain Coordinates for d4kl6a1:

Click to download the PDB-style file with coordinates for d4kl6a1.
(The format of our PDB-style files is described here.)

Timeline for d4kl6a1: