Lineage for d4kl5a_ (4kl5 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1561198Fold b.86: Hedgehog/intein (Hint) domain [51293] (1 superfamily)
    complex fold made of five beta-hairpin units and a b-ribbon arc
  4. 1561199Superfamily b.86.1: Hedgehog/intein (Hint) domain [51294] (3 families) (S)
    duplication: contains two intertwined structural repeats
  5. 1561233Family b.86.1.0: automated matches [254252] (1 protein)
    not a true family
  6. 1561234Protein automated matches [254576] (1 species)
    not a true protein
  7. 1561235Species Nostoc punctiforme [TaxId:63737] [255340] (3 PDB entries)
  8. 1561236Domain d4kl5a_: 4kl5 A: [253312]
    automated match to d4o1ra_
    complexed with cit, gol

Details for d4kl5a_

PDB Entry: 4kl5 (more details), 1.72 Å

PDB Description: crystal structure of npudnae intein
PDB Compounds: (A:) DNA polymerase III, alpha subunit, Nucleic acid binding, OB-fold, tRNA/helicase-type chimeric construct

SCOPe Domain Sequences for d4kl5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kl5a_ b.86.1.0 (A:) automated matches {Nostoc punctiforme [TaxId: 63737]}
galsyeteiltveygllpigkivekriectvysvdnngniytqpvaqwhdrgeqevfeyc
ledgsliratkdhkfmtvdgqmlpideifereldlmrvdnlpnikiatrkylgkqnvydi
gverdhnfalkngfiasnad

SCOPe Domain Coordinates for d4kl5a_:

Click to download the PDB-style file with coordinates for d4kl5a_.
(The format of our PDB-style files is described here.)

Timeline for d4kl5a_: