Lineage for d4kkcf2 (4kkc F:107-211)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1764220Domain d4kkcf2: 4kkc F:107-211 [253311]
    Other proteins in same PDB: d4kkca_, d4kkcb_, d4kkcd1, d4kkcf1
    automated match to d1ikfl2
    mutant

Details for d4kkcf2

PDB Entry: 4kkc (more details), 3.18 Å

PDB Description: Structure of the E148A mutant of CLC-ec1 deltaNC construct in 20mM Bromide
PDB Compounds: (F:) Fab, light chain

SCOPe Domain Sequences for d4kkcf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kkcf2 b.1.1.2 (F:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOPe Domain Coordinates for d4kkcf2:

Click to download the PDB-style file with coordinates for d4kkcf2.
(The format of our PDB-style files is described here.)

Timeline for d4kkcf2: