Lineage for d1d7qa_ (1d7q A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2382744Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2383132Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 protein domains)
    barrel, closed; n=5, S=8
  6. 2383596Protein Translation initiation factor-1a, eIF1a [50292] (1 species)
  7. 2383597Species Human (Homo sapiens) [TaxId:9606] [50293] (1 PDB entry)
  8. 2383598Domain d1d7qa_: 1d7q A: [25331]

Details for d1d7qa_

PDB Entry: 1d7q (more details)

PDB Description: human translation initiation factor eif1a
PDB Compounds: (A:) translation initiation factor 1a

SCOPe Domain Sequences for d1d7qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7qa_ b.40.4.5 (A:) Translation initiation factor-1a, eIF1a {Human (Homo sapiens) [TaxId: 9606]}
pknkgkggknrrrgknenesekrelvfkedgqeyaqvikmlgngrleamcfdgvkrlchi
rgklrkkvwintsdiilvglrdyqdnkadvilkynadearslkaygelpehakinetdtf
gpgdddeiqfddigdddediddi

SCOPe Domain Coordinates for d1d7qa_:

Click to download the PDB-style file with coordinates for d1d7qa_.
(The format of our PDB-style files is described here.)

Timeline for d1d7qa_: