| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d4kkbf2: 4kkb F:107-211 [253305] Other proteins in same PDB: d4kkba_, d4kkbb_, d4kkbc_, d4kkbd1, d4kkbe_, d4kkbf1 automated match to d1ikfl2 mutant |
PDB Entry: 4kkb (more details), 3.02 Å
SCOPe Domain Sequences for d4kkbf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kkbf2 b.1.1.2 (F:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra
Timeline for d4kkbf2: