Lineage for d1ah9a_ (1ah9 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 950107Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 950437Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 950889Protein Translational initiation factor 1, IF1 [50290] (1 species)
  7. 950890Species Escherichia coli [TaxId:562] [50291] (3 PDB entries)
  8. 950892Domain d1ah9a_: 1ah9 A: [25330]

Details for d1ah9a_

PDB Entry: 1ah9 (more details)

PDB Description: the structure of the translational initiation factor if1 from escherichia coli, nmr, 19 structures
PDB Compounds: (A:) initiation factor 1

SCOPe Domain Sequences for d1ah9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ah9a_ b.40.4.5 (A:) Translational initiation factor 1, IF1 {Escherichia coli [TaxId: 562]}
akedniemqgtvletlpntmfrvelenghvvtahisgkmrknyiriltgdkvtveltpyd
lskgrivfrsr

SCOPe Domain Coordinates for d1ah9a_:

Click to download the PDB-style file with coordinates for d1ah9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ah9a_: