Lineage for d1ah9__ (1ah9 -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.40: OB-fold [50198] (8 superfamilies) 
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families) 
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (13 proteins) 
Protein Translational initiation factor 1, IF1 [50290] (1 species) Species Escherichia coli [TaxId:562] [50291] (2 PDB entries) 
Domain d1ah9__: 1ah9 - [25330]
Details for d1ah9__
PDB Entry: 1ah9 (more details)
PDB Description: the structure of the translational initiation factor if1 from escherichia coli, nmr, 19 structures
SCOP Domain Sequences for d1ah9__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ah9__ b.40.4.5 (-) Translational initiation factor 1, IF1 {Escherichia coli}
akedniemqgtvletlpntmfrvelenghvvtahisgkmrknyiriltgdkvtveltpyd
lskgrivfrsr
SCOP Domain Coordinates for d1ah9__:
Click to download the PDB-style file with coordinates for d1ah9__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ah9__:
- d1ah9__ first appeared (with stable ids) in SCOP 1.55
- d1ah9__ appears in SCOP 1.57
- d1ah9__ appears in SCOP 1.61
- d1ah9__ appears in the current release, SCOPe 2.08, called d1ah9a_
View in 3D