Lineage for d1hr0w_ (1hr0 W:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2790154Protein Translational initiation factor 1, IF1 [50290] (1 species)
  7. 2790155Species Escherichia coli [TaxId:562] [50291] (3 PDB entries)
  8. 2790156Domain d1hr0w_: 1hr0 W: [25329]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0d_, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_
    complexed with mg, zn

Details for d1hr0w_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit
PDB Compounds: (W:) translation initiation factor

SCOPe Domain Sequences for d1hr0w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0w_ b.40.4.5 (W:) Translational initiation factor 1, IF1 {Escherichia coli [TaxId: 562]}
akekdtirtegvvtealpnatfrvkldsgpeilayisgkmrmhyirilpgdrvvveitpy
dptrgrivyrk

SCOPe Domain Coordinates for d1hr0w_:

Click to download the PDB-style file with coordinates for d1hr0w_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0w_: