SCOPe 2.08: Domain d4kk6f1: 4kk6 F:1-106

Lineage for d4kk6f1 (4kk6 F:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4kk6f1: 4kk6 F:1-106 [253286]
   Other proteins in same PDB: d4kk6a_, d4kk6b_, d4kk6c_, d4kk6d2, d4kk6e_, d4kk6f2
   automated match to d1ikfl1
   complexed with br

Details for d4kk6f1

PDB Entry: 4kk6, 3.18 Å

PDB Description: Structure of CLC-ec1 deltaNC construct in 20mM Bromide

PDB Compounds: (F:) Fab, light chain

SCOPe Domain Sequences for d4kk6f1:

Sequence; same for both SEQRES and ATOM records:

>d4kk6f1 b.1.1.0 (F:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleil

Timeline for d4kk6f1:

• d4kk6f1 first appeared in SCOPe 2.04
  
• d4kk6f1 appears in SCOPe 2.07