SCOPe 2.08: Domain d4kk6d2: 4kk6 D:107-211

Lineage for d4kk6d2 (4kk6 D:107-211)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d4kk6d2: 4kk6 D:107-211 [253285]
Other proteins in same PDB: d4kk6a_, d4kk6b_, d4kk6c_, d4kk6d1, d4kk6e_, d4kk6f1
automated match to d1ikfl2
complexed with br

Details for d4kk6d2

PDB Entry: 4kk6 (more details), 3.18 Å

PDB Description: Structure of CLC-ec1 deltaNC construct in 20mM Bromide

PDB Compounds: (D:) Fab, light chain

SCOPe Domain Sequences for d4kk6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kk6d2 b.1.1.2 (D:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

SCOPe Domain Coordinates for d4kk6d2:

Click to download the PDB-style file with coordinates for d4kk6d2.
(The format of our PDB-style files is described here.)

Timeline for d4kk6d2: