SCOPe 2.07: Domain d4kk5f2: 4kk5 F:107-211

Lineage for d4kk5f2 (4kk5 F:107-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d4kk5f2: 4kk5 F:107-211 [253281]
   Other proteins in same PDB: d4kk5a_, d4kk5b_, d4kk5d1, d4kk5f1
   automated match to d1ikfl2

Details for d4kk5f2

PDB Entry: 4kk5, 3.17 Å

PDB Description: Structure of the CLC-ec1 deltaNC construct in 20mM fluoride and 20mM bromide

PDB Compounds: (F:) Fab, light chain

SCOPe Domain Sequences for d4kk5f2:

Sequence; same for both SEQRES and ATOM records:

>d4kk5f2 b.1.1.2 (F:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

Timeline for d4kk5f2:

• d4kk5f2 first appeared in SCOPe 2.04
  
• d4kk5f2 appears in SCOPe 2.06
  
• d4kk5f2 appears in the current release, SCOPe 2.08