| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
| Domain d4kk5f2: 4kk5 F:107-211 [253281] Other proteins in same PDB: d4kk5a_, d4kk5b_, d4kk5c_, d4kk5d1, d4kk5e_, d4kk5f1 automated match to d1ikfl2 |
PDB Entry: 4kk5 (more details), 3.17 Å
SCOPe Domain Sequences for d4kk5f2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kk5f2 b.1.1.2 (F:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra
Timeline for d4kk5f2: