Lineage for d1sroa_ (1sro A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789071Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1789487Protein S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase [50287] (2 species)
  7. 1789488Species Escherichia coli [TaxId:562] [50288] (1 PDB entry)
  8. 1789489Domain d1sroa_: 1sro A: [25327]
    CASP2

Details for d1sroa_

PDB Entry: 1sro (more details)

PDB Description: s1 rna binding domain, nmr, 20 structures
PDB Compounds: (A:) pnpase

SCOPe Domain Sequences for d1sroa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sroa_ b.40.4.5 (A:) S1 RNA-binding domain of polyribonucleotide phosphorylase, PNPase {Escherichia coli [TaxId: 562]}
aeievgrvytgkvtrivdfgafvaigggkeglvhisqiadkrvekvtdylqmgqevpvkv
levdrqgrirlsikea

SCOPe Domain Coordinates for d1sroa_:

Click to download the PDB-style file with coordinates for d1sroa_.
(The format of our PDB-style files is described here.)

Timeline for d1sroa_: