Lineage for d4kjwb_ (4kjw B:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629845Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2629846Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2629847Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 2629895Protein automated matches [226846] (4 species)
    not a true protein
  7. 2629896Species Escherichia coli K-12 [TaxId:83333] [224947] (14 PDB entries)
  8. 2629910Domain d4kjwb_: 4kjw B: [253269]
    Other proteins in same PDB: d4kjwd1, d4kjwd2, d4kjwf1, d4kjwf2
    automated match to d1kpla_

Details for d4kjwb_

PDB Entry: 4kjw (more details), 3.03 Å

PDB Description: Structure of the CLC-ec1 deltaNC construct in 100mM fluoride and 20mM bromide
PDB Compounds: (B:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d4kjwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kjwb_ f.20.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnypl
lltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffgglg
tlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplagi
lfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyli
lgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsgggf
nlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvave
lfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatllaq
ftggkplysailartlakqea

SCOPe Domain Coordinates for d4kjwb_:

Click to download the PDB-style file with coordinates for d4kjwb_.
(The format of our PDB-style files is described here.)

Timeline for d4kjwb_: