Lineage for d4kjwa_ (4kjw A:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577647Fold f.20: Clc chloride channel [81341] (1 superfamily)
    core: 18 transmembrane helices
  4. 2577648Superfamily f.20.1: Clc chloride channel [81340] (1 family) (S)
  5. 2577649Family f.20.1.1: Clc chloride channel [69912] (2 proteins)
    duplication: consist of two similar structural parts
  6. 2577697Protein automated matches [226846] (3 species)
    not a true protein
  7. 2577698Species Escherichia coli K-12 [TaxId:83333] [224947] (14 PDB entries)
  8. 2577711Domain d4kjwa_: 4kjw A: [253268]
    Other proteins in same PDB: d4kjwd1, d4kjwd2, d4kjwf1, d4kjwf2
    automated match to d1kpla_

Details for d4kjwa_

PDB Entry: 4kjw (more details), 3.03 Å

PDB Description: Structure of the CLC-ec1 deltaNC construct in 100mM fluoride and 20mM bromide
PDB Compounds: (A:) H(+)/Cl(-) exchange transporter clcA

SCOPe Domain Sequences for d4kjwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kjwa_ f.20.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
gtlgggmvlgregptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
qftggkplysailartlakqeaeq

SCOPe Domain Coordinates for d4kjwa_:

Click to download the PDB-style file with coordinates for d4kjwa_.
(The format of our PDB-style files is described here.)

Timeline for d4kjwa_: