SCOPe 2.05: Domain d4kila_: 4kil A:

Lineage for d4kila_ (4kil A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.34: PA N-terminal domain [254166] (2 proteins)
   Pfam PF00603; relationship to endonucleases discussed in PubMed 19194458

6. Protein PA N-terminal domain [254375] (5 species)

7. Species Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId:985958] [256341] (11 PDB entries)

8. Domain d4kila_: 4kil A: [253267]
   automated match to d3ebja_
   complexed with 1r5, edo, mn, so4

Details for d4kila_

PDB Entry: 4kil, 1.75 Å

PDB Description: 7-(4-fluorophenyl)-3-hydroxyquinolin-2(1H)-one bound to influenza 2009 H1N1 endonuclease

PDB Compounds: (A:) polymerase pa

SCOPe Domain Sequences for d4kila_:

Sequence; same for both SEQRES and ATOM records:

>d4kila_ c.52.1.34 (A:) PA N-terminal domain {Influenza a virus (a/lima/wrair1695p/2009(h1n1)) [TaxId: 985958]}
gplgsmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdfhfid
ergesiivesgdpnallkhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydyken
rfieigvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrl
ftirqemasrslwdsfrqse

Timeline for d4kila_:

• d4kila_ first appeared in SCOPe 2.04
  
• d4kila_ is called d4kila1 in SCOPe 2.06
  
• d4kila_ appears in the current release, SCOPe 2.08, called d4kila1