Lineage for d1c9ob_ (1c9o B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14165Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (9 proteins)
  6. 14172Protein Major cold shock protein [50283] (3 species)
  7. 14173Species Bacillus caldolyticus [TaxId:1394] [50286] (1 PDB entry)
  8. 14175Domain d1c9ob_: 1c9o B: [25326]

Details for d1c9ob_

PDB Entry: 1c9o (more details), 1.17 Å

PDB Description: crystal structure analysis of the bacillus caldolyticus cold shock protein bc-csp

SCOP Domain Sequences for d1c9ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c9ob_ b.40.4.5 (B:) Major cold shock protein {Bacillus caldolyticus}
mqrgkvkwfnnekgygfieveggsdvfvhftaiqgegfktleegqevsfeivqgnrgpqa
anvvkl

SCOP Domain Coordinates for d1c9ob_:

Click to download the PDB-style file with coordinates for d1c9ob_.
(The format of our PDB-style files is described here.)

Timeline for d1c9ob_:

14175
d1c9ob_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1c9oa_