Lineage for d1nmga_ (1nmg A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541496Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1541584Protein Major cold shock protein [50283] (4 species)
  7. 1541600Species Bacillus subtilis [TaxId:1423] [50285] (10 PDB entries)
  8. 1541611Domain d1nmga_: 1nmg A: [25324]

Details for d1nmga_

PDB Entry: 1nmg (more details)

PDB Description: major cold-shock protein, nmr, minimized average structure
PDB Compounds: (A:) major cold-shock protein

SCOPe Domain Sequences for d1nmga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmga_ b.40.4.5 (A:) Major cold shock protein {Bacillus subtilis [TaxId: 1423]}
mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
anvtkea

SCOPe Domain Coordinates for d1nmga_:

Click to download the PDB-style file with coordinates for d1nmga_.
(The format of our PDB-style files is described here.)

Timeline for d1nmga_: