Lineage for d4ke6f_ (4ke6 F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2136079Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2136080Protein automated matches [190543] (90 species)
    not a true protein
  7. 2136114Species Bacillus sp. [TaxId:129908] [256061] (7 PDB entries)
  8. 2136138Domain d4ke6f_: 4ke6 F: [253239]
    automated match to d1r1da_
    complexed with 1qw, mpd; mutant

Details for d4ke6f_

PDB Entry: 4ke6 (more details), 2.8 Å

PDB Description: crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol
PDB Compounds: (F:) Thermostable monoacylglycerol lipase

SCOPe Domain Sequences for d4ke6f_:

Sequence, based on SEQRES records: (download)

>d4ke6f_ c.69.1.0 (F:) automated matches {Bacillus sp. [TaxId: 129908]}
qypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgthye
dmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpinaav
dipaiaagmtgggelpryldsigsdlknpdvkelayektptasllqlarlmaqtkakldr
ivcpalifvsdenhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiersle
ffakha

Sequence, based on observed residues (ATOM records): (download)

>d4ke6f_ c.69.1.0 (F:) automated matches {Bacillus sp. [TaxId: 129908]}
qypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgthye
dmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpinaav
dipasdlknpdvkelayektptasllqlarlmaqtkakldrivcpalifvsdenhvvppg
nadiifqgisstekeivrlrnsyhvatldydqpmiiersleffakha

SCOPe Domain Coordinates for d4ke6f_:

Click to download the PDB-style file with coordinates for d4ke6f_.
(The format of our PDB-style files is described here.)

Timeline for d4ke6f_: