Lineage for d4ke6d_ (4ke6 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2901965Species Bacillus sp. [TaxId:129908] [256061] (7 PDB entries)
  8. 2901987Domain d4ke6d_: 4ke6 D: [253237]
    automated match to d1r1da_
    complexed with 1qw, mpd; mutant

Details for d4ke6d_

PDB Entry: 4ke6 (more details), 2.8 Å

PDB Description: crystal structure d196n mutant of monoglyceride lipase from bacillus sp. h257 in complex with 1-rac-lauroyl glycerol
PDB Compounds: (D:) Thermostable monoacylglycerol lipase

SCOPe Domain Sequences for d4ke6d_:

Sequence, based on SEQRES records: (download)

>d4ke6d_ c.69.1.0 (D:) automated matches {Bacillus sp. [TaxId: 129908]}
seqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgth
yedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpina
avdipaiaagmtgggelpryldsigsdlknpdvkelayektptasllqlarlmaqtkakl
drivcpalifvsdenhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiers
leffakha

Sequence, based on observed residues (ATOM records): (download)

>d4ke6d_ c.69.1.0 (D:) automated matches {Bacillus sp. [TaxId: 129908]}
seqypvlsgaepfyaengpvgvllvhgftgtphsmrplaeayakagytvclprlkghgth
yedmerttfhdwvasveegygwlkqrcqtifvtglsmggtltlylaehhpdicgivpina
avdipapryldsigsdlknpdvkelayektptasllqlarlmaqtkakldrivcpalifv
sdenhvvppgnadiifqgisstekeivrlrnsyhvatldydqpmiiersleffakha

SCOPe Domain Coordinates for d4ke6d_:

Click to download the PDB-style file with coordinates for d4ke6d_.
(The format of our PDB-style files is described here.)

Timeline for d4ke6d_: