Lineage for d4kamb_ (4kam B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132682Species Mycobacterium marinum [TaxId:216594] [226100] (2 PDB entries)
  8. 2132684Domain d4kamb_: 4kam B: [253221]
    automated match to d2ctza1
    complexed with so4

Details for d4kamb_

PDB Entry: 4kam (more details), 2 Å

PDB Description: x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m
PDB Compounds: (B:) O-acetylhomoserine sulfhydrylase MetC

SCOPe Domain Sequences for d4kamb_:

Sequence, based on SEQRES records: (download)

>d4kamb_ c.67.1.0 (B:) automated matches {Mycobacterium marinum [TaxId: 216594]}
ptahwsfetkqihagqqpdsatnaralpiyqttsytfentahaaalfglevpgniytrlg
npttdvveqriaaleggvaalflssgqaaetfailnlagagdhivssprlyggtynlfhy
slaklgievsfvddpdnldswqaavrpntkaffgetisnpqidlldtpgvaevahrngip
livdntiatpylirpftqgadivvhsatkylgghgaaiagvivdggtfdwtqgrfpeftt
pdpsyhgvvfaelgapayalkarvqllrdlgsaaspfnaflvaqgletlslrierhvsna
qrvaefladredvvtvnyaglpgspwherakklspkgtgavlsfelaggveagkafvnal
klhshvanigdvrslvihpastthaqlspaeqlstgvspglvrlavgiegiediladlel
gfaaarkf

Sequence, based on observed residues (ATOM records): (download)

>d4kamb_ c.67.1.0 (B:) automated matches {Mycobacterium marinum [TaxId: 216594]}
ptahwsfetkqihagqnaralpiyqttstrlgnpttdvveqriaaleggvaalflssgqa
aetfailnlagagdhivssprlyggtynlfhyslaklgievsfvddpdnldswqaavrpn
tkaffgetisnpqidlldtpgvaevahrngiplivdntiatpylirpftqgadivvhsat
kylgghgaaiagvivdggtfdwtqgrfpefttpdpsyhgvvfaelgapayalkarvqllr
dlgsaaspfnaflvaqgletlslrierhvsnaqrvaefladredvvtvnyaglpgspwhe
rakklspkgtgavlsfelaggveagkafvnalklhshvanigdvrslvihspglvrlavg
iegiediladlelgfaaarkf

SCOPe Domain Coordinates for d4kamb_:

Click to download the PDB-style file with coordinates for d4kamb_.
(The format of our PDB-style files is described here.)

Timeline for d4kamb_: