SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4kama_ (4kam A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (108 species)
    not a true protein
  7. 2132682Species Mycobacterium marinum [TaxId:216594] [226100] (2 PDB entries)
  8. 2132683Domain d4kama_: 4kam A: [253220]
    automated match to d2ctza1
    complexed with so4

Details for d4kama_

PDB Entry: 4kam (more details), 2 Å

PDB Description: x-ray crystal structure of o-acetylhomoserine sulfhydrylase metc from mycobacterium marinum atcc baa-535 / m
PDB Compounds: (A:) O-acetylhomoserine sulfhydrylase MetC

SCOPe Domain Sequences for d4kama_:

Sequence, based on SEQRES records: (download)

>d4kama_ c.67.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}
ptahwsfetkqihagqqpdsatnaralpiyqttsytfentahaaalfglevpgniytrlg
npttdvveqriaaleggvaalflssgqaaetfailnlagagdhivssprlyggtynlfhy
slaklgievsfvddpdnldswqaavrpntkaffgetisnpqidlldtpgvaevahrngip
livdntiatpylirpftqgadivvhsatkylgghgaaiagvivdggtfdwtqgrfpeftt
pdpsyhgvvfaelgapayalkarvqllrdlgsaaspfnaflvaqgletlslrierhvsna
qrvaefladredvvtvnyaglpgspwherakklspkgtgavlsfelaggveagkafvnal
klhshvanigdvrslvihpastthaqlspaeqlstgvspglvrlavgiegiediladlel
gfaaarkfs

Sequence, based on observed residues (ATOM records): (download)

>d4kama_ c.67.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}
ptahwsfetkqihagqqpdsalpiyqttsnpttdvveqriaaleggvaalflssgqaaet
failnlagagdhivssprlyggtynlfhyslaklgievsfvddpdnldswqaavrpntka
ffgetisnpqidlldtpgvaevahrngiplivdntiatpylirpftqgadivvhsatkyl
gghgaaiagvivdggtfdwtqgrfpefttpdpsyhgvvfaelgapayalkarvqllrdlg
saaspfnaflvaqgletlslrierhvsnaqrvaefladredvvtvnyaglpgspwherak
klspkgtgavlsfelaggveagkafvnalklhshvanigdvrslvihglvrlavgiegie
diladlelgfaaarkfs

SCOPe Domain Coordinates for d4kama_:

Click to download the PDB-style file with coordinates for d4kama_.
(The format of our PDB-style files is described here.)

Timeline for d4kama_: