Lineage for d1csqa_ (1csq A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
    barrel, closed; n=5, S=8
  6. 799801Protein Major cold shock protein [50283] (4 species)
  7. 799817Species Bacillus subtilis [TaxId:1423] [50285] (6 PDB entries)
  8. 799820Domain d1csqa_: 1csq A: [25322]

Details for d1csqa_

PDB Entry: 1csq (more details), 2.7 Å

PDB Description: crystal structure of the bacillus subtilis major cold shock protein, cspb: a universal nucleic-acid binding domain
PDB Compounds: (A:) cold shock protein b(cspb)

SCOP Domain Sequences for d1csqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1csqa_ b.40.4.5 (A:) Major cold shock protein {Bacillus subtilis [TaxId: 1423]}
mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
anvtkea

SCOP Domain Coordinates for d1csqa_:

Click to download the PDB-style file with coordinates for d1csqa_.
(The format of our PDB-style files is described here.)

Timeline for d1csqa_: