Lineage for d1csq__ (1csq -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13574Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 14052Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 14165Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (9 proteins)
  6. 14172Protein Major cold shock protein [50283] (3 species)
  7. 14176Species Bacillus subtilis [TaxId:1423] [50285] (4 PDB entries)
  8. 14178Domain d1csq__: 1csq - [25322]

Details for d1csq__

PDB Entry: 1csq (more details), 2.7 Å

PDB Description: crystal structure of the bacillus subtilis major cold shock protein, cspb: a universal nucleic-acid binding domain

SCOP Domain Sequences for d1csq__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1csq__ b.40.4.5 (-) Major cold shock protein {Bacillus subtilis}
mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
anvtkea

SCOP Domain Coordinates for d1csq__:

Click to download the PDB-style file with coordinates for d1csq__.
(The format of our PDB-style files is described here.)

Timeline for d1csq__: