| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
| Protein automated matches [227126] (21 species) not a true protein |
| Species Pseudomonas putida [TaxId:303] [254984] (38 PDB entries) |
| Domain d4k9pb3: 4k9p B:342-526 [253213] Other proteins in same PDB: d4k9pa2, d4k9pb2, d4k9pc2, d4k9pd2 automated match to d1q6za3 complexed with ca, gol, mg, tpp; mutant |
PDB Entry: 4k9p (more details), 2.24 Å
SCOPe Domain Sequences for d4k9pb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k9pb3 c.36.1.0 (B:342-526) automated matches {Pseudomonas putida [TaxId: 303]}
epakvdqdagrlhpetvfdtlndmapenaiylneststtaqmwqrlnmrnpgsyyfcaag
glgfalpaaigvqlaeperqviavigdgsanysisalwtaaqyniptifvimnngtygil
rwfagvleaenvpgldvpgidfralakgygvqalkadnleqlkgslqealsakgpvliev
stvsp
Timeline for d4k9pb3: