SCOPe 2.07: Domain d1cspa_: 1csp A:

Lineage for d1cspa_ (1csp A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
   barrel, closed; n=5, S=8

6. Protein Major cold shock protein [50283] (4 species)

7. Species Bacillus subtilis [TaxId:1423] [50285] (12 PDB entries)

8. Domain d1cspa_: 1csp A: [25321]

Details for d1cspa_

PDB Entry: 1csp, 2.45 Å

PDB Description: crystal structure of the bacillus subtilis major cold shock protein, cspb: a universal nucleic-acid binding domain

PDB Compounds: (A:) cold shock protein b(cspb)

SCOPe Domain Sequences for d1cspa_:

Sequence; same for both SEQRES and ATOM records:

>d1cspa_ b.40.4.5 (A:) Major cold shock protein {Bacillus subtilis [TaxId: 1423]}
mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqavsfeivegnrgpqa
anvtkea

Timeline for d1cspa_:

• d1cspa_ first appeared (with stable ids) in SCOP 1.55, called d1csp__
  
• d1cspa_ appears in SCOPe 2.06
  
• d1cspa_ appears in the current release, SCOPe 2.08