Lineage for d3mefa_ (3mef A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1124635Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1124965Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 1125049Protein Major cold shock protein [50283] (4 species)
  7. 1125078Species Escherichia coli [TaxId:562] [50284] (2 PDB entries)
  8. 1125080Domain d3mefa_: 3mef A: [25320]

Details for d3mefa_

PDB Entry: 3mef (more details)

PDB Description: major cold-shock protein from escherichia coli solution nmr structure
PDB Compounds: (A:) protein (cold-shock protein a)

SCOPe Domain Sequences for d3mefa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mefa_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]}
sgkmtgivkwfnadkgfgfitpddgskdvfvhfsaiqndgyksldegqkvsftiesgakg
paagnvtsl

SCOPe Domain Coordinates for d3mefa_:

Click to download the PDB-style file with coordinates for d3mefa_.
(The format of our PDB-style files is described here.)

Timeline for d3mefa_: