Lineage for d1mjca_ (1mjc A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 949212Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 950107Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 950437Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
    barrel, closed; n=5, S=8
  6. 950521Protein Major cold shock protein [50283] (4 species)
  7. 950550Species Escherichia coli [TaxId:562] [50284] (2 PDB entries)
  8. 950551Domain d1mjca_: 1mjc A: [25319]

Details for d1mjca_

PDB Entry: 1mjc (more details), 2 Å

PDB Description: crystal structure of cspa, the major cold shock protein of escherichia coli
PDB Compounds: (A:) major cold-shock protein 7.4

SCOPe Domain Sequences for d1mjca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjca_ b.40.4.5 (A:) Major cold shock protein {Escherichia coli [TaxId: 562]}
sgkmtgivkwfnadkgfgfitpddgskdvfvhfsaiqndgyksldegqkvsftiesgakg
paagnvtsl

SCOPe Domain Coordinates for d1mjca_:

Click to download the PDB-style file with coordinates for d1mjca_.
(The format of our PDB-style files is described here.)

Timeline for d1mjca_: