![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
![]() | Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) ![]() binds cofactor molecules in the opposite direction than classical Rossmann fold |
![]() | Family c.31.1.3: Pyruvate oxidase and decarboxylase, middle domain [52475] (8 proteins) N-terminal domain is Pyr module, and C-terminal domain is PP module of thiamin diphosphate-binding fold |
![]() | Protein Benzoylformate decarboxylase [52482] (1 species) |
![]() | Species Pseudomonas putida [TaxId:303] [52483] (41 PDB entries) Uniprot P20906 |
![]() | Domain d4k9nb2: 4k9n B:182-341 [253188] Other proteins in same PDB: d4k9na1, d4k9na3, d4k9nb1, d4k9nb3, d4k9nc1, d4k9nc3, d4k9nd1, d4k9nd3 automated match to d1q6za1 complexed with gol, mg, tzd; mutant |
PDB Entry: 4k9n (more details), 1.7 Å
SCOPe Domain Sequences for d4k9nb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k9nb2 c.31.1.3 (B:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} svrlndqdldilvkalnsasnpaivlgpdvdaananadcvmlaerlkapvwvapsaprcp fptrhpcfrglmpagiaaisqlleghdvvlvigapvfryhqydpgqylkpgtrlisvtcd pleaarapmgdaivadigamasalanlveessrqlptaap
Timeline for d4k9nb2: