SCOPe 2.06: Domain d1e7za1: 1e7z A:148-319

Lineage for d1e7za1 (1e7z A:148-319)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)

5. Family b.40.4.4: Myf domain [50277] (7 proteins)

6. Protein EMAP II [50280] (1 species)
   domain of the p43 protein

7. Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries)

8. Domain d1e7za1: 1e7z A:148-319 [25318]
   Other proteins in same PDB: d1e7za2
   contains C-terminal His tag
   protein/RNA complex; complexed with hg

Details for d1e7za1

PDB Entry: 1e7z, 2.05 Å

PDB Description: crystal structure of the emap2/rna binding domain of the p43 protein from human aminoacyl-trna synthetase complex

PDB Compounds: (A:) endothelial-monocyte activating polypeptide II

SCOPe Domain Sequences for d1e7za1:

Sequence; same for both SEQRES and ATOM records:

>d1e7za1 b.40.4.4 (A:148-319) EMAP II {Human (Homo sapiens) [TaxId: 9606]}
kpidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmv
illcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpk
kkiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgiklehhhhh

Timeline for d1e7za1:

• d1e7za1 first appeared (with stable ids) in SCOP 1.55, called d1e7za_
  
• d1e7za1 was called d1e7za_ in SCOPe 2.05
  
• d1e7za1 appears in SCOPe 2.07
  
• d1e7za1 appears in the current release, SCOPe 2.08