SCOPe 2.08: Domain d4k9el1: 4k9e L:2-110

Lineage for d4k9el1 (4k9e L:2-110)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4k9el1: 4k9e L:2-110 [253173]
   Other proteins in same PDB: d4k9eh_, d4k9el2, d4k9el3
   automated match to d1um5l1
   complexed with nag

Details for d4k9el1

PDB Entry: 4k9e, 2.7 Å

PDB Description: crystal structure of kit d4d5 fragment in complex with anti-kit antibodies fab79d

PDB Compounds: (L:) light chain

SCOPe Domain Sequences for d4k9el1:

Sequence; same for both SEQRES and ATOM records:

>d4k9el1 b.1.1.0 (L:2-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqmtqspsslsasvgdrvtitcrasqrglrnvavawyqqkpgkapklliysasslysgvp
srfsgsrsgtdftltisslqpedfatyycqqwavhslitfgqgtkveik

Timeline for d4k9el1:

• d4k9el1 first appeared in SCOPe 2.04
  
• d4k9el1 appears in SCOPe 2.07