![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
![]() | Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) ![]() |
![]() | Family d.218.1.15: cGAMP synthase, cGAS N-terminal domain [254174] (1 protein) Pfam PF03281; PubMed 23647843; structurally very similar to hOAS1 (d.218.1.6) |
![]() | Protein cGAMP synthase, cGAS N-terminal domain [254394] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [254830] (1 PDB entry) |
![]() | Domain d4k8vd1: 4k8v D:147-393 [253171] Other proteins in same PDB: d4k8va2, d4k8va3, d4k8vb2, d4k8vb3, d4k8vc2, d4k8vc3, d4k8vd2, d4k8vd3 complexed with zn |
PDB Entry: 4k8v (more details), 2 Å
SCOPe Domain Sequences for d4k8vd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k8vd1 d.218.1.15 (D:147-393) cGAMP synthase, cGAS N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} pdklkkvldklrlkrkdiseaaetvnkvverllrrmqkresefkgveqlntgsyyehvki sapnefdvmfklevprielqeyyetgafylvkfkriprgnplshflegevlsatkmlskf rkiikeevkeikdidvsvekekpgspavtllirnpeeisvdiilaleskgswpistkegl piqgwlgtkvrtnlrrepfylvpknakdgnsfqgetwrlsfshtekyilnnhgiektcce ssgakcc
Timeline for d4k8vd1: