Lineage for d4k8vd1 (4k8v D:147-393)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006866Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 3006867Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 3007353Family d.218.1.15: cGAMP synthase, cGAS N-terminal domain [254174] (1 protein)
    Pfam PF03281; PubMed 23647843; structurally very similar to hOAS1 (d.218.1.6)
  6. 3007354Protein cGAMP synthase, cGAS N-terminal domain [254394] (2 species)
  7. 3007355Species Mouse (Mus musculus) [TaxId:10090] [254830] (1 PDB entry)
  8. 3007359Domain d4k8vd1: 4k8v D:147-393 [253171]
    Other proteins in same PDB: d4k8va2, d4k8va3, d4k8vb2, d4k8vb3, d4k8vc2, d4k8vc3, d4k8vd2, d4k8vd3
    complexed with zn

Details for d4k8vd1

PDB Entry: 4k8v (more details), 2 Å

PDB Description: Structure of cyclic GMP-AMP Synthase (cGAS)
PDB Compounds: (D:) Cyclic GMP-AMP synthase

SCOPe Domain Sequences for d4k8vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k8vd1 d.218.1.15 (D:147-393) cGAMP synthase, cGAS N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
pdklkkvldklrlkrkdiseaaetvnkvverllrrmqkresefkgveqlntgsyyehvki
sapnefdvmfklevprielqeyyetgafylvkfkriprgnplshflegevlsatkmlskf
rkiikeevkeikdidvsvekekpgspavtllirnpeeisvdiilaleskgswpistkegl
piqgwlgtkvrtnlrrepfylvpknakdgnsfqgetwrlsfshtekyilnnhgiektcce
ssgakcc

SCOPe Domain Coordinates for d4k8vd1:

Click to download the PDB-style file with coordinates for d4k8vd1.
(The format of our PDB-style files is described here.)

Timeline for d4k8vd1: