SCOPe 2.04: Domain d4k8vc2: 4k8v C:394-507

Lineage for d4k8vc2 (4k8v C:394-507)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily)
   core: 5-helical bundle; up-and-down; right-handed twist

4. Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families)
   this domain follows the catalytic nucleotidyltransferase domain

5. Family a.160.1.6: cGAMP synthase, cGAS C-terminal domain [254175] (1 protein)
   PubMed 23647843; structurally very similar to hOAS1 (a.160.1.2)

6. Protein cGAMP synthase, cGAS C-terminal domain [254395] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [254831] (1 PDB entry)

8. Domain d4k8vc2: 4k8v C:394-507 [253170]
   Other proteins in same PDB: d4k8va1, d4k8vb1, d4k8vc1, d4k8vd1
   complexed with zn

Details for d4k8vc2

PDB Entry: 4k8v, 2 Å

PDB Description: Structure of cyclic GMP-AMP Synthase (cGAS)

PDB Compounds: (C:) Cyclic GMP-AMP synthase

SCOPe Domain Sequences for d4k8vc2:

Sequence; same for both SEQRES and ATOM records:

>d4k8vc2 a.160.1.6 (C:394-507) cGAMP synthase, cGAS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
rkeclklmkylleqlkkefqeldafcsyhvktaifhmwtqdpqdsqwdprnlsscfdkll
affleclrtekldhyfipkfnlfsqelidrkskeflskkieyernngfpifdkl

Timeline for d4k8vc2:

• d4k8vc2 is new in SCOPe 2.04-stable
  
• d4k8vc2 appears in SCOPe 2.05
  
• d4k8vc2 appears in the current release, SCOPe 2.08