Lineage for d1eujb_ (1euj B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789623Family b.40.4.4: Myf domain [50277] (7 proteins)
  6. 2789647Protein EMAP II [50280] (1 species)
    domain of the p43 protein
  7. 2789648Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries)
  8. 2789652Domain d1eujb_: 1euj B: [25317]

Details for d1eujb_

PDB Entry: 1euj (more details), 1.8 Å

PDB Description: a novel anti-tumor cytokine contains a rna-binding motif present in aminoacyl-trna synthetases
PDB Compounds: (B:) endothelial monocyte activating polypeptide 2

SCOPe Domain Sequences for d1eujb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eujb_ b.40.4.4 (B:) EMAP II {Human (Homo sapiens) [TaxId: 9606]}
pidvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvi
llcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkk
kiweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgik

SCOPe Domain Coordinates for d1eujb_:

Click to download the PDB-style file with coordinates for d1eujb_.
(The format of our PDB-style files is described here.)

Timeline for d1eujb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1euja_