Class a: All alpha proteins [46456] (285 folds) |
Fold a.160: PAP/OAS1 substrate-binding domain [81632] (1 superfamily) core: 5-helical bundle; up-and-down; right-handed twist |
Superfamily a.160.1: PAP/OAS1 substrate-binding domain [81631] (7 families) this domain follows the catalytic nucleotidyltransferase domain |
Family a.160.1.6: cGAMP synthase, cGAS C-terminal domain [254175] (1 protein) PubMed 23647843; structurally very similar to hOAS1 (a.160.1.2) |
Protein cGAMP synthase, cGAS C-terminal domain [254395] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [254831] (1 PDB entry) |
Domain d4k8vb2: 4k8v B:394-507 [253168] Other proteins in same PDB: d4k8va1, d4k8vb1, d4k8vc1, d4k8vd1 complexed with zn |
PDB Entry: 4k8v (more details), 2 Å
SCOPe Domain Sequences for d4k8vb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k8vb2 a.160.1.6 (B:394-507) cGAMP synthase, cGAS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} rkeclklmkylleqlkkefqeldafcsyhvktaifhmwtqdpqdsqwdprnlsscfdkll affleclrtekldhyfipkfnlfsqelidrkskeflskkieyernngfpifdkl
Timeline for d4k8vb2: