| Class b: All beta proteins [48724] (180 folds) |
| Fold b.8: TRAF domain-like [49598] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.8.1: TRAF domain-like [49599] (3 families) ![]() has a circularly permuted immunoglobulin-fold topology with extra strand |
| Family b.8.1.0: automated matches [227285] (1 protein) not a true family |
| Protein automated matches [227102] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [256340] (2 PDB entries) |
| Domain d4k8uc_: 4k8u C: [253164] automated match to d1lb6a_ |
PDB Entry: 4k8u (more details), 2.3 Å
SCOPe Domain Sequences for d4k8uc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k8uc_ b.8.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrreleelsvgsdgvliwkigsygrrlqeakakpnlecfspafythkygyklqvsaflng
ngsgegthlslyirvlpgafdnllewpfarrvtfslldqsdpglakpqhvtetfhpdpnw
knfqkpgtwrgsldesslgfgypkfishqdirkrnyvrddavfiraavelprkils
Timeline for d4k8uc_: