Lineage for d4k8ua_ (4k8u A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773292Fold b.8: TRAF domain-like [49598] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773293Superfamily b.8.1: TRAF domain-like [49599] (3 families) (S)
    has a circularly permuted immunoglobulin-fold topology with extra strand
  5. 2773417Family b.8.1.0: automated matches [227285] (1 protein)
    not a true family
  6. 2773418Protein automated matches [227102] (2 species)
    not a true protein
  7. 2773419Species Human (Homo sapiens) [TaxId:9606] [256340] (2 PDB entries)
  8. 2773423Domain d4k8ua_: 4k8u A: [253162]
    automated match to d1lb6a_

Details for d4k8ua_

PDB Entry: 4k8u (more details), 2.3 Å

PDB Description: crystal structure of traf4 traf domain
PDB Compounds: (A:) TNF receptor-associated factor 4

SCOPe Domain Sequences for d4k8ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k8ua_ b.8.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
elqelrreleelsvgsdgvliwkigsygrrlqeakakpnlecfspafythkygyklqvsa
flngngsgegthlslyirvlpgafdnllewpfarrvtfslldqsdpglakpqhvtetfhp
dpnwknfqkpgtwrgsldesslgfgypkfishqdirkrnyvrddavfiraavelprki

SCOPe Domain Coordinates for d4k8ua_:

Click to download the PDB-style file with coordinates for d4k8ua_.
(The format of our PDB-style files is described here.)

Timeline for d4k8ua_: