Lineage for d4k66g1 (4k66 G:5-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775998Domain d4k66g1: 4k66 G:5-324 [253158]
    Other proteins in same PDB: d4k66a2, d4k66b_, d4k66c2, d4k66d_, d4k66e2, d4k66f_, d4k66g2, d4k66h_
    automated match to d4kdma_
    complexed with nag; mutant

Details for d4k66g1

PDB Entry: 4k66 (more details), 3.01 Å

PDB Description: structure of an airborne transmissible avian influenza h5 hemagglutinin mutant from the influenza virus a/indonesia/5/2005 complexed with avian receptor analog lsta
PDB Compounds: (G:) Hemagglutinin

SCOPe Domain Sequences for d4k66g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k66g1 b.19.1.2 (G:5-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanptndlcypgsfndyeelkyllsrinhfekiqiipks
swsdheassgvssacpylgspsffrnvvwlikknsayptikksynntnqedllvlwgihh
pndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvnglssrmeffwtilkpndain
fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrns

SCOPe Domain Coordinates for d4k66g1:

Click to download the PDB-style file with coordinates for d4k66g1.
(The format of our PDB-style files is described here.)

Timeline for d4k66g1: