Lineage for d4k66d_ (4k66 D:)

  1. Root: SCOPe 2.07
  2. 2590057Class h: Coiled coil proteins [57942] (7 folds)
  3. 2591558Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2591559Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2591560Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2591561Protein Influenza hemagglutinin (stalk) [58066] (14 species)
    trimer
  7. 2591653Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2591901Domain d4k66d_: 4k66 D: [253155]
    Other proteins in same PDB: d4k66a1, d4k66a2, d4k66c1, d4k66c2, d4k66e1, d4k66e2, d4k66g1, d4k66g2
    automated match to d2ypgb_
    complexed with nag; mutant

Details for d4k66d_

PDB Entry: 4k66 (more details), 3 Å

PDB Description: Structure of an airborne transmissible avian influenza H5 hemagglutinin mutant from the influenza virus A/Indonesia/5/2005 complexed with avian receptor analog LSTa
PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d4k66d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k66d_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesirngtynypqyse

SCOPe Domain Coordinates for d4k66d_:

Click to download the PDB-style file with coordinates for d4k66d_.
(The format of our PDB-style files is described here.)

Timeline for d4k66d_: