Lineage for d4k66b_ (4k66 B:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267243Domain d4k66b_: 4k66 B: [253153]
    Other proteins in same PDB: d4k66a1, d4k66a2, d4k66c1, d4k66c2, d4k66e1, d4k66e2, d4k66g1, d4k66g2
    automated match to d2ypgb_
    complexed with nag; mutant

Details for d4k66b_

PDB Entry: 4k66 (more details), 3 Å

PDB Description: Structure of an airborne transmissible avian influenza H5 hemagglutinin mutant from the influenza virus A/Indonesia/5/2005 complexed with avian receptor analog LSTa
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d4k66b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k66b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesirngtynypqyse

SCOPe Domain Coordinates for d4k66b_:

Click to download the PDB-style file with coordinates for d4k66b_.
(The format of our PDB-style files is described here.)

Timeline for d4k66b_: