Lineage for d1fl0a_ (1fl0 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) 
Family b.40.4.4: Myf domain [50277] (2 proteins) Protein EMAP II [50280] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50281] (3 PDB entries) 
Domain d1fl0a_: 1fl0 A: [25315]
Details for d1fl0a_
PDB Entry: 1fl0 (more details), 1.5 Å
PDB Description: crystal structure of the emap2/rna-binding domain of the p43 protein from human aminoacyl-trna synthetase complex
SCOP Domain Sequences for d1fl0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fl0a_ b.40.4.4 (A:) EMAP II {Human (Homo sapiens)}
idvsrldlrigciitarkhpdadslyveevdvgeiaprtvvsglvnhvpleqmqnrmvil
lcnlkpakmrgvlsqamvmcasspekieilappngsvpgdritfdafpgepdkelnpkkk
iweqiqpdlhtndecvatykgvpfevkgkgvcraqtmsnsgikl
SCOP Domain Coordinates for d1fl0a_:
Click to download the PDB-style file with coordinates for d1fl0a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fl0a_:
- d1fl0a_ appears in SCOP 1.57
- d1fl0a_ appears in the current release, SCOPe 2.08, called d1fl0a1
View in 3D