Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries) |
Domain d4k63b_: 4k63 B: [253145] Other proteins in same PDB: d4k63a1, d4k63a2, d4k63c1, d4k63c2, d4k63e1, d4k63e2, d4k63g1, d4k63g2 automated match to d2ypgb_ complexed with nag |
PDB Entry: 4k63 (more details), 3.1 Å
SCOPe Domain Sequences for d4k63b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4k63b_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd kvrlqlrdnakelgngcfefyhkcdnecmesirngtynypqyse
Timeline for d4k63b_: