Lineage for d4k63a1 (4k63 A:5-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775958Domain d4k63a1: 4k63 A:5-324 [253144]
    Other proteins in same PDB: d4k63a2, d4k63b_, d4k63c2, d4k63d_, d4k63e2, d4k63f_, d4k63g2, d4k63h_
    automated match to d4kdma_
    complexed with nag

Details for d4k63a1

PDB Entry: 4k63 (more details), 3.1 Å

PDB Description: structure of an avian influenza h5 hemagglutinin from the influenza virus complexed with avian receptor analog lsta
PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d4k63a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4k63a1 b.19.1.2 (A:5-324) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanptndlcypgsfndyeelkhllsrinhfekiqiipks
swsdheassgvssacpylgspsffrnvvwlikknstyptikksynntnqedllvlwgihh
pndaaeqtrlyqnpttyisigtstlnqrlvpkiatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdsaimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrns

SCOPe Domain Coordinates for d4k63a1:

Click to download the PDB-style file with coordinates for d4k63a1.
(The format of our PDB-style files is described here.)

Timeline for d4k63a1: