| Class b: All beta proteins [48724] (110 folds) |
| Fold b.40: OB-fold [50198] (8 superfamilies) |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (9 families) ![]() |
| Family b.40.4.4: Myf domain [50277] (3 proteins) |
| Protein Domain B2 of PheRS-beta, PheT [50278] (1 species) |
| Species Thermus thermophilus (Thermus aquaticus) [50279] (5 PDB entries) |
| Domain d1eiyb3: 1eiy B:39-151 [25314] Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb1, d1eiyb2, d1eiyb4, d1eiyb5, d1eiyb6 |
PDB Entry: 1eiy (more details), 3.3 Å
SCOP Domain Sequences for d1eiyb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eiyb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp
Timeline for d1eiyb3: