Lineage for d1eiyb3 (1eiy B:39-151)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58940Fold b.40: OB-fold [50198] (7 superfamilies)
  4. 59438Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families) (S)
  5. 59542Family b.40.4.4: Myf domain [50277] (3 proteins)
  6. 59549Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)
  7. 59550Species Thermus thermophilus (Thermus aquaticus) [50279] (4 PDB entries)
  8. 59554Domain d1eiyb3: 1eiy B:39-151 [25314]
    Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb1, d1eiyb2, d1eiyb4, d1eiyb5, d1eiyb6

Details for d1eiyb3

PDB Entry: 1eiy (more details), 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe

SCOP Domain Sequences for d1eiyb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiyb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOP Domain Coordinates for d1eiyb3:

Click to download the PDB-style file with coordinates for d1eiyb3.
(The format of our PDB-style files is described here.)

Timeline for d1eiyb3: