SCOP 1.55: Domain d1eiyb3: 1eiy B:39-151

Lineage for d1eiyb3 (1eiy B:39-151)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (8 families)

5. Family b.40.4.4: Myf domain [50277] (2 proteins)

6. Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)

7. Species Thermus thermophilus (Thermus aquaticus) [50279] (4 PDB entries)

8. Domain d1eiyb3: 1eiy B:39-151 [25314]
   Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb1, d1eiyb2, d1eiyb4, d1eiyb5, d1eiyb6

Details for d1eiyb3

PDB Entry: 1eiy, 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe

SCOP Domain Sequences for d1eiyb3:

Sequence; same for both SEQRES and ATOM records:

>d1eiyb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus (Thermus aquaticus)}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOP Domain Coordinates for d1eiyb3 are not available.

Timeline for d1eiyb3:

• d1eiyb3 appears in SCOP 1.57
  
• d1eiyb3 appears in the current release, SCOPe 2.08