Lineage for d1eiyb3 (1eiy B:39-151)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789623Family b.40.4.4: Myf domain [50277] (7 proteins)
  6. 2789633Protein Domain B2 of PheRS-beta, PheT [50278] (1 species)
  7. 2789634Species Thermus thermophilus [TaxId:274] [50279] (12 PDB entries)
    identical sequence to Thermus aquaticus, TaxId: 271
  8. 2789646Domain d1eiyb3: 1eiy B:39-151 [25314]
    Other proteins in same PDB: d1eiya1, d1eiya2, d1eiyb1, d1eiyb2, d1eiyb4, d1eiyb5, d1eiyb6
    protein/RNA complex

Details for d1eiyb3

PDB Entry: 1eiy (more details), 3.3 Å

PDB Description: the crystal structure of phenylalanyl-trna synthetase from thermus thermophilus complexed with cognate trnaphe
PDB Compounds: (B:) phenylalanyl-tRNA synthetase

SCOPe Domain Sequences for d1eiyb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiyb3 b.40.4.4 (B:39-151) Domain B2 of PheRS-beta, PheT {Thermus thermophilus [TaxId: 274]}
fpiprgvvfarvleahpipgtrlkrlvldagrtvevvsgaenarkgigvalalpgtelpg
lgqkvgerviqgvrsfgmalsprelgvgeygggllefpedalppgtplseawp

SCOPe Domain Coordinates for d1eiyb3:

Click to download the PDB-style file with coordinates for d1eiyb3.
(The format of our PDB-style files is described here.)

Timeline for d1eiyb3: